Protein Info for PP_1373 in Pseudomonas putida KT2440

Annotation: phosphate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 80 (29 residues), see Phobius details amino acids 92 to 115 (24 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 155 to 180 (26 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details amino acids 371 to 392 (22 residues), see Phobius details amino acids 414 to 434 (21 residues), see Phobius details amino acids 463 to 485 (23 residues), see Phobius details PF01384: PHO4" amino acids 30 to 478 (449 residues), 306.6 bits, see alignment E=1.2e-95

Best Hits

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 100% identity to ppu:PP_1373)

Predicted SEED Role

"Low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88N43 at UniProt or InterPro

Protein Sequence (490 amino acids)

>PP_1373 phosphate transporter (Pseudomonas putida KT2440)
MIDLFSGLDAWVLVSLLLALTFVLAFEFINGFHDTANAVATVIYTKAMPPHLAVFFSGVF
NFLGVLLGGVGVAYAIVHLLPVELLINVNTGHGLAMVFSLLAAAITWNLGTWYFGIPASS
SHTLIGSILGVGLANALINDIPLGDGVNWQKAIDIAMSLVVSPMAGFAVAALVLIGLKWW
RPLSKMHKTPEQRRKLDDKKHPPFWNRLVLVVSAMGVSFVHGSNDGQKGIGLIMLVLIGI
VPAKFVLDLNSTTYQIERTRDATLHMSQFYQRNAATLGEFLALGKAKASDLPEQFSCNPQ
QTEPTIAALQTSLKGVTDYHSLDAEKRVEVRRYLLCLDDTAKKVGKLPGLDAREKSDLEK
LRKDLTATTEYAPFWVIVAVALALGLGTMVGWKRVVLTVGEKIGKQGMTYAQGMSAQITA
ACAIGMANVFALPVSTTHVLSSGVAGTMVANKSGLQGGTVKTILLAWVLTLPASMGLAAG
LFWLASKAIG