Protein Info for PP_1355 in Pseudomonas putida KT2440

Annotation: Muropeptide permease AmpG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 29 to 30 (2 residues), see Phobius details amino acids 53 to 69 (17 residues), see Phobius details amino acids 90 to 107 (18 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details amino acids 317 to 342 (26 residues), see Phobius details amino acids 357 to 376 (20 residues), see Phobius details amino acids 383 to 402 (20 residues), see Phobius details amino acids 413 to 434 (22 residues), see Phobius details amino acids 446 to 465 (20 residues), see Phobius details amino acids 473 to 493 (21 residues), see Phobius details PF13000: Acatn" amino acids 20 to 168 (149 residues), 24.6 bits, see alignment E=9.4e-10 PF07690: MFS_1" amino acids 21 to 323 (303 residues), 40.1 bits, see alignment E=2.2e-14 TIGR00901: AmpG-like permease" amino acids 29 to 455 (427 residues), 434.4 bits, see alignment E=1.9e-134

Best Hits

KEGG orthology group: K08218, MFS transporter, PAT family, beta-lactamase induction signal transducer AmpG (inferred from 99% identity to ppf:Pput_4369)

Predicted SEED Role

"AmpG permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88N61 at UniProt or InterPro

Protein Sequence (515 amino acids)

>PP_1355 Muropeptide permease AmpG (Pseudomonas putida KT2440)
MPRKTWRAALAAYASPSTLVLLLLGFAAGLPYMLVFSTLSVWLREAGVARETIGYASLIG
LAYAFKWVWSPLLDQWRLPLLGGLGRRRSWLLLSQALVVIGLVGMSLCDPQQHLSWLIAM
AVLVAFASATQDIAVDAYRLEIADDQRQAALAASYMAGYRVAALLATAGALFFAEWFGST
GFSYLHKAWAGTYVMFGVMMLPALFTTLVMREPSVPMRTQLSAARYGLVHQMASVFVLII
LLVSVPASFTQMFNTGWSSVISGDATPLDLLLEDRAFLRLILYVLLSWACLSSLGRRGLA
PVLTPINDFITRYRWQALLLLGLIATYRMSDTVMGVMANVFYIDMGFTKDQIASVSKIFG
LVMTLVGAGVGGLLIVRFGIMPILFIGGVASAGTNILFLMLADMGPNLEMLVVTISLDNF
SSGMATSAFVAYLSSLTNLKFSATQYALLSSIMLLLPRLIGGYSGVIVEKFGYHDFFLIT
ALLGVPTLILIALQWHQEAGRGTPVADDHSVAERP