Protein Info for PP_1353 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 64 to 89 (26 residues), see Phobius details amino acids 95 to 125 (31 residues), see Phobius details PF21088: MS_channel_1st" amino acids 71 to 111 (41 residues), 26.3 bits, see alignment 8.7e-10 PF00924: MS_channel_2nd" amino acids 113 to 179 (67 residues), 76 bits, see alignment E=3.1e-25 PF21082: MS_channel_3rd" amino acids 185 to 266 (82 residues), 56.8 bits, see alignment E=3.7e-19

Best Hits

Swiss-Prot: 38% identical to MSCS_EDWI9: Small-conductance mechanosensitive channel (mscS) from Edwardsiella ictaluri (strain 93-146)

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 100% identity to ppu:PP_1353)

MetaCyc: 39% identical to small conductance mechanosensitive channel MscS (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88N63 at UniProt or InterPro

Protein Sequence (282 amino acids)

>PP_1353 conserved membrane protein of unknown function (Pseudomonas putida KT2440)
MNMDLNAEVDQLVRQSQTWIPLIMEYGSRVLLALLTLAVGWWIINKVSARLGKLVGLRNA
DLALQGFISTLANIVLKVLLLVSVASMIGIETTSFVAAIGAAGLAIGLALQGSLANFAGG
VLILMFRPFRIGDWIEAQGVAGTVDSIQIFHTVLRTGDNKTVIMPNGSLSNGIITNTNRQ
PTRKVVFDVGVDYEADLQKARNVLLELAKDPRVLQDPAPQAVVSTLGDSSITVSLRLWTK
TSDYWDVMFMLNEYARDRLKAEGIDIPFPQRVIRVVQETATQ