Protein Info for PP_1348 in Pseudomonas putida KT2440

Annotation: putative MutT/nudix family protein/thiamine-phosphate pyrophosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details TIGR00586: mutator mutT protein" amino acids 1 to 125 (125 residues), 117.5 bits, see alignment E=2e-38 PF00293: NUDIX" amino acids 6 to 124 (119 residues), 77.3 bits, see alignment E=1.7e-25 PF14815: NUDIX_4" amino acids 8 to 124 (117 residues), 93.7 bits, see alignment E=1e-30 PF02581: TMP-TENI" amino acids 132 to 309 (178 residues), 127.9 bits, see alignment E=4.2e-41

Best Hits

KEGG orthology group: K03574, 7,8-dihydro-8-oxoguanine triphosphatase [EC: 3.6.1.-] (inferred from 100% identity to ppu:PP_1348)

Predicted SEED Role

"Mutator mutT protein (7,8-dihydro-8-oxoguanine-triphosphatase) (EC 3.6.1.-) / Thiamin-phosphate pyrophosphorylase-like protein" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88N67 at UniProt or InterPro

Protein Sequence (314 amino acids)

>PP_1348 putative MutT/nudix family protein/thiamine-phosphate pyrophosphorylase (Pseudomonas putida KT2440)
MKRIHVVAAVIRGADGRILIARRADTQHQGGLWEFPGGKVEEGESVEAALARELREELGI
EVSRSRALIKVSHDYPDKQVLLDVREVEAFTGEPHGAEGQPLEWVAPRDLPQYEFPEANK
PIVAAARLPDQYLITPDGLEVPQLLKGIQKAVANGIRLIQLRAPDMYDPKYRDVAVDAVG
LCAGKAQLMLKGPLEWLGDFPAAGWHLTAAQLRKYAARGRPFPKERWLAASCHSAEELAL
AEQMGVDFVTLSPVQATQTHPEAVPLGWDEAQRLTAGFNKPVYLLGGVGPSEREQAWEAG
AQGVAGIRAFWPEV