Protein Info for PP_1347 in Pseudomonas putida KT2440

Annotation: Glutathione S-transferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02798: GST_N
  • amino acids 12 to 76 (65 residues), 32.5 bits, E=1.8e-11
• PF13409: GST_N_2
  • amino acids 12 to 78 (67 residues), 53.7 bits, E=5e-18
• PF13417: GST_N_3
  • amino acids 12 to 81 (70 residues), 47.6 bits, E=3.4e-16
• PF13410: GST_C_2
  • amino acids 135 to 202 (68 residues), 27.1 bits, E=7.5e-10

Best Hits

KEGG orthology group: K04097, glutathione S-transferase [EC: 2.5.1.18] (inferred from 100% identity to ppu:PP_1347)

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (4/10 steps found)
• gliotoxin biosynthesis (2/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

See Q88N68 at UniProt or InterPro

Protein Sequence (210 amino acids)

>PP_1347 Glutathione S-transferase family protein (Pseudomonas putida KT2440)
MSYHLIIGDKLYSSWSLRGALALELAGVPYEETLIKLNQPDTRQRILAFSSTGKVPLLKT
EHGVIADSLAIAEYLNEQHPDAQLWPADAAARAQARSACAQMHSGFFALRGAMPFDLSRD
QALDTVPLDVQVDIDRIVALWSECRVVAKDSGPFLFGKPSLADAFFAPVAVRLRTYRVEV
PAEAAAYIETIYQWPAFQAWQQAGLEERKA