Protein Info for PP_1329 in Pseudomonas putida KT2440

Annotation: Ribosomal RNA small subunit methyltransferase H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF01795: Methyltransf_5" amino acids 7 to 313 (307 residues), 364.1 bits, see alignment E=3.6e-113 TIGR00006: 16S rRNA (cytosine(1402)-N(4))-methyltransferase" amino acids 7 to 313 (307 residues), 363 bits, see alignment E=7.4e-113

Best Hits

Swiss-Prot: 100% identical to RSMH_PSEPK: Ribosomal RNA small subunit methyltransferase H (rsmH) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03438, S-adenosyl-methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to ppf:Pput_4395)

MetaCyc: 56% identical to 16S rRNA m4C1402 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11638 [EC: 2.1.1.199]

Predicted SEED Role

"rRNA small subunit methyltransferase H" in subsystem Bacterial Cell Division

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.199

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88N84 at UniProt or InterPro

Protein Sequence (315 amino acids)

>PP_1329 Ribosomal RNA small subunit methyltransferase H (Pseudomonas putida KT2440)
MTIDSGFNHITVLLDEAVEALALRADGCYLDGTFGRGGHSRLILSKLGPQGRLLGFDKDP
QAIATGQALAAEDGRFVIVQRSFAELGAEVAARGLHGKVSGVLLDLGVSSPQLDDPERGF
SFLNDGPLDMRMNPDQGVSAAEFIATAPVEEIARVFKEYGEERFAGRMARAVVERREKQP
FTRTADLAEVLKVANPAWEKGKNPATRAFQGLRIHVNNELGDLEAGLEAALDALEVGGRL
AVISFHSLEDRIVKLFMRKLVKGEADNLPRNLPVQHKVFEPKIKLIGKAQFASEAELKAN
PRSRSAVMRVAEKLR