Protein Info for PP_1319 in Pseudomonas putida KT2440

Annotation: Ubiquinol--cytochrome c reductase, cytochrome c1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K00413, ubiquinol-cytochrome c reductase cytochrome c1 subunit [EC: 1.10.2.2] (inferred from 100% identity to ppu:PP_1319)

Predicted SEED Role

"ubiquinol cytochrome C oxidoreductase, cytochrome C1 subunit" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes

KEGG Metabolic Maps

Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88N93 at UniProt or InterPro

Protein Sequence (259 amino acids)

>PP_1319 Ubiquinol--cytochrome c reductase, cytochrome c1 (Pseudomonas putida KT2440)
MKKLIAVFLLAVMPAFSFAAEHGLELDKVDIDLTDKAAMQDGARTFANYCMGCHSAKFQR
YERVADDLGIPHELMLEKLVFTGAKIGDHMQIGMKPSDAKTWFGAAPPDLTLVARVRGTD
WLYTYLRSFYEDPSRPYGVNNKVFPNVGMPNVLVGLQGNQVVGCKQVQTVVDGKKQFDPL
TGSPLTHEACDQLTITPNSGTLTAEQFDEKVKNLVTFLAYSANPVKLESQRIGTYVLLYL
AFFFVFAYLLKREYWKDVH