Protein Info for PP_1310 in Pseudomonas putida KT2440

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 102 to 121 (20 residues), see Phobius details PF12146: Hydrolase_4" amino acids 27 to 140 (114 residues), 37.7 bits, see alignment E=4.5e-13 PF00561: Abhydrolase_1" amino acids 31 to 123 (93 residues), 34 bits, see alignment E=7.7e-12 PF02129: Peptidase_S15" amino acids 56 to 120 (65 residues), 27.9 bits, see alignment E=5.6e-10 PF00975: Thioesterase" amino acids 88 to 137 (50 residues), 36.8 bits, see alignment E=1.6e-12

Best Hits

KEGG orthology group: K07018, (no description) (inferred from 99% identity to ppf:Pput_4414)

Predicted SEED Role

"Alpha/beta hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NA2 at UniProt or InterPro

Protein Sequence (211 amino acids)

>PP_1310 conserved hypothetical protein (Pseudomonas putida KT2440)
MLVRETPLFIDGPSGQLEALYLDVANARGAVLICHPNPVQGGTMLNKVVSTLQRTARDAG
YVTLRFNYRGVGQSAGSHDMGAGEVADAEAAAAWLRARHPGLPLVLMGFSFGGFVATSLA
GRLETAGVELQHLFMIAPAVMRLTAEFPMPQRCPLTVVQPDADEVVAPQLVYEWSDSLSR
PHELLKVAECGHFFHGKLTDLKDLLLPRLSN