Protein Info for PP_1308 in Pseudomonas putida KT2440

Annotation: methionine gamma-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01328: methionine gamma-lyase
  • amino acids 8 to 396 (389 residues), 571.1 bits, E=5.3e-176
• PF01053: Cys_Met_Meta_PP
  • amino acids 12 to 395 (384 residues), 467.7 bits, E=3.2e-144
• PF00155: Aminotran_1_2
  • amino acids 67 to 191 (125 residues), 39 bits, E=8.8e-14
• PF06838: Met_gamma_lyase
  • amino acids 84 to 234 (151 residues), 43.4 bits, E=2.7e-15

Best Hits

Swiss-Prot: 83% identical to MEGL_PSEPU: L-methionine gamma-lyase (mdeA) from Pseudomonas putida

KEGG orthology group: K01761, methionine-gamma-lyase [EC: 4.4.1.11] (inferred from 100% identity to ppu:PP_1308)

MetaCyc: 83% identical to MdeA (Pseudomonas putida)
Methionine gamma-lyase. [EC: 4.4.1.11]

Predicted SEED Role

"Methionine gamma-lyase (EC 4.4.1.11)" in subsystem Methionine Degradation (EC 4.4.1.11)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-methionine degradation II (3/3 steps found)
• seleno-amino acid detoxification and volatilization III (2/3 steps found)
• L-threonine degradation I (4/6 steps found)
• dimethyl sulfide biosynthesis from methionine (1/2 steps found)
• seleno-amino acid detoxification and volatilization I (1/2 steps found)
• superpathway of L-threonine metabolism (12/18 steps found)
• superpathway of seleno-compound metabolism (8/19 steps found)
• hypoglycin biosynthesis (4/14 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.11

Sequence Analysis Tools

See Q88NA4 at UniProt or InterPro

Protein Sequence (398 amino acids)

>PP_1308 methionine gamma-lyase (Pseudomonas putida KT2440)
MRDSHHNTGFSTRAIHHGYDPLSHGGALVPPVYQTATYAFPTVEYGAACFAGEEPGHFYS
RISNPTLALLEQRMASLEGGEAGLALASGMGAITSTLWTLLRPGDELIVGRTLYGCTFAF
LHHGIGEFGVKVRHVDLNDAKALKAAISSKTRMIYFETPANPNMQLVDIAAVVEAVRGHD
VHVVVDNTYCTPYLQRPLELGADLVVHSATKYLSGHGDITAGLVVGRKVLVDRIRLEGLK
DMTGAVLSPHDAALLMRGIKTLALRMDRHCANAQQVAEFLVRQPQVELIHYPGLPSFAQY
ALAQRQMRLPGGMIAFELKGGIEAGRRFMNALQLFARAVSLGDAESLAQHPASMTHSSYT
PQERAHHGISEGLVRLSVGLEDVEDLLADVEQALQACC