Protein Info for PP_1301 in Pseudomonas putida KT2440

Annotation: quality control serine endoprotease DegS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details PF00089: Trypsin" amino acids 123 to 280 (158 residues), 63.5 bits, see alignment E=6.6e-21 PF13365: Trypsin_2" amino acids 123 to 257 (135 residues), 111.4 bits, see alignment E=1.6e-35 PF00595: PDZ" amino acids 292 to 375 (84 residues), 39.7 bits, see alignment E=1.3e-13 PF13180: PDZ_2" amino acids 297 to 383 (87 residues), 55.2 bits, see alignment E=1.7e-18 PF17820: PDZ_6" amino acids 328 to 373 (46 residues), 33.4 bits, see alignment 7.6e-12

Best Hits

KEGG orthology group: K04691, serine protease DegS [EC: 3.4.21.-] (inferred from 100% identity to ppu:PP_1301)

Predicted SEED Role

"Outer membrane stress sensor protease DegS" in subsystem Proteolysis in bacteria, ATP-dependent

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NB1 at UniProt or InterPro

Protein Sequence (402 amino acids)

>PP_1301 quality control serine endoprotease DegS (Pseudomonas putida KT2440)
MPHCQAAGPCSFQDSFMFKALRYFGWPLLTGILIAMLIIQRFPQWVGLPSQDVNLQQAPQ
TTRIMQGPVSYADAVTLAAPAVANLYTTKVVNKSAHPLFEDPQFRRFFGDNLPKQRRWES
SLGSAVIMSPEGYLLTNNHVTSGADQIVVALKDGRETLARVIGSDPETDLAVLKIDLKNL
PAITIGRSDTIHIGDVSLAIGNPFGVGQTVTMGIISATGRNQLGLNNYEDFIQTDAAINP
GNSGGALVDANGNLIGINTAIFSKSGGSQGIGFAIPVKLALEVMKSIVEHGQVIRGWLGI
EVQPLSQELAESFGMKDRPGIVVAGIFREGPAAKAGLHLGDVILSINGEPAGDGRKSMNQ
VARIKPNEKITIEVMRNGQQLKLIAEVGLRPPPAPAASQEEK