Protein Info for PP_1292 in Pseudomonas putida KT2440

Annotation: Cyclic pyranopterin monophosphate synthase accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00581: molybdenum cofactor biosynthesis protein C
  • amino acids 2 to 149 (148 residues), 229.8 bits, E=5.2e-73
• PF01967: MoaC
  • amino acids 13 to 147 (135 residues), 197.6 bits, E=4.2e-63

Best Hits

Swiss-Prot: 100% identical to MOAC_PSEPK: Cyclic pyranopterin monophosphate synthase (moaC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03637, molybdenum cofactor biosynthesis protein C (inferred from 98% identity to ppw:PputW619_0899)

MetaCyc: 70% identical to cyclic pyranopterin monophosphate synthase (Escherichia coli K-12 substr. MG1655)
RXN-17809 [EC: 4.6.1.17]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaC" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

• molybdopterin biosynthesis (4/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.6.1.17

Sequence Analysis Tools

See Q88NC0 at UniProt or InterPro

Protein Sequence (156 amino acids)

>PP_1292 Cyclic pyranopterin monophosphate synthase accessory protein (Pseudomonas putida KT2440)
MLTHLDSQGRANMVDVTEKAVTEREATAEARVRMLPQTLQMIVDGEHPKGDVFAVARIAG
IQAAKKTSDLIPLCHPLMLTSVKVELSAEGQDAVRIVARCKLAGQTGVEMEALTAASVAA
LTIYDMCKAVDKGMVIEQVRLLEKLGGKSGHYKVEA