Protein Info for PP_1289 in Pseudomonas putida KT2440

Annotation: conserved protein of unknown function, DUF328 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF03883: H2O2_YaaD" amino acids 1 to 243 (243 residues), 323.5 bits, see alignment E=4.1e-101

Best Hits

Swiss-Prot: 100% identical to Y1289_PSEPK: UPF0246 protein PP_1289 (PP_1289) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K09861, hypothetical protein (inferred from 100% identity to ppu:PP_1289)

Predicted SEED Role

"UPF0246 protein YaaA" in subsystem YaaA

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NC3 at UniProt or InterPro

Protein Sequence (259 amino acids)

>PP_1289 conserved protein of unknown function, DUF328 family (Pseudomonas putida KT2440)
MLTVISPAKTLDYDTPPVTERFTLPQYLDESQALIQQLRELSPAQISELMHLSDKLAGLN
AARFGSWTPDFTPANAKQALLAFKGDVYTGLDAESLSEDDFSYAQGHLRMLSGLYGLLRP
LDLMQPYRLEMGTKLANARGKDLYAFWGTRISEWLNQALADQGDDVLLNLASNEYFSAVK
RSALKARVINVDFKDQKNGQYKIISFYAKKARGMMSRFVIQQRISTPEQLKQFDAQGYYY
SAEQSKPDHLVFLRDHPAE