Protein Info for PP_1283 in Pseudomonas putida KT2440

Annotation: poly(beta-D-mannuronate) C5 epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF05048: NosD" amino acids 264 to 393 (130 residues), 49.5 bits, see alignment E=3.8e-17 amino acids 353 to 419 (67 residues), 26.1 bits, see alignment E=5.3e-10 PF13229: Beta_helix" amino acids 275 to 419 (145 residues), 57.6 bits, see alignment E=1.2e-19 TIGR03804: parallel beta-helix repeat" amino acids 371 to 411 (41 residues), 26.7 bits, see alignment 1.7e-10

Best Hits

Swiss-Prot: 100% identical to ALGG_PSEPK: Mannuronan C5-epimerase (algG) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_4442)

MetaCyc: 68% identical to mannuronan C5 epimerase (Pseudomonas aeruginosa)
RXN-9839 [EC: 5.1.3.37]; TRANS-RXN-269 [EC: 5.1.3.37]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NC9 at UniProt or InterPro

Protein Sequence (519 amino acids)

>PP_1283 poly(beta-D-mannuronate) C5 epimerase (Pseudomonas putida KT2440)
MNLHPHLRHSLLASALLLASGLATAAEPQVIAKELQQAKTYTVASAPIEPLQMDPPKLPD
LTGFTAEAVQKKIDRRHKGKVSLRRMFQEDTLKEFVGGDNKAAEWVQRQHGIPQAIFVDD
GHVDLTELSKKVPKQYFSEVEPGVYLARLPIVVGQKGILEIDGKVKQLRLSQEGGAFLVN
DGKLFVTDTQVTGWREKDNGPATFRSPKEFRPFLLSWGGTETYIVNTKMASFGYAKSKSY
GVSISQYTPNMAKRMGRPEPTGWIIGSEFSDMWYGFYCYETQDFVIKDSTYRDNIVYGID
PHDRSHRLIIAGNTVYGTKKKHGIIVSREVNDSWIINNKSYDNKLSGVVIDRNSVNNLVA
YNEIYRNHTDGITLYESGDNLIWGNKLVNNRRHGIRVRNSVNIRLYENVAMANGLVGVYG
HIKDLSDTDRDIALDPFDTKVSLIVVGGELSANGSGPLSIDSPLSVELYKVSMLAPRKAS
GISLNGVLGERQDEILDLLVRQQKAVLIDPVERQTEMID