Protein Info for PP_1264 in Pseudomonas putida KT2440

Annotation: putative Fusaric acid resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 725 transmembrane" amino acids 30 to 49 (20 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 105 to 122 (18 residues), see Phobius details amino acids 129 to 147 (19 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 392 to 414 (23 residues), see Phobius details amino acids 420 to 437 (18 residues), see Phobius details amino acids 446 to 467 (22 residues), see Phobius details amino acids 473 to 490 (18 residues), see Phobius details amino acids 497 to 516 (20 residues), see Phobius details amino acids 528 to 546 (19 residues), see Phobius details PF04632: FUSC" amino acids 30 to 714 (685 residues), 729.1 bits, see alignment E=6.1e-223 PF13515: FUSC_2" amino acids 44 to 173 (130 residues), 50.2 bits, see alignment E=2.8e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_4459)

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NE8 at UniProt or InterPro

Protein Sequence (725 amino acids)

>PP_1264 putative Fusaric acid resistance protein (Pseudomonas putida KT2440)
MSTSSLPVRWLQSLEWRRGFFAWARTDGVTWVYIFKVLAAAFITLWLAMRLELPQPRTAM
ITVFIVMQPQSGHVFAKSFYRVLGTLAGSAMMVALIAIFPQNTELFLPSLALWVGLCSAG
AMRYRTFRAYGFVLAGYTAAMIGLPVLQHPDQAFMAAVWRALEIALGILVSTFVSAAILP
QSASAAMRNALYQRFGVFAGVVVEALRGDSQKDRFESSNVRFVAEAVGLESLRNVTAFED
PHMRRRSGRLVRMNSEFMAITTRFNALHRLLERLRARGPLQIVSAIEPGLNTLVELLQPY
VGRALTDADALRLTLELAAYKEGLQAQVRGLRAEYLATDPSESDLLDFHTAFELLYRFVD
EMLSYAETHASLAAHKHEREQWDEPYVAQTSWLVSLAAGVRASAVLLLLGSYWLLSDWPS
GAMMTLIATVTVCLSAASPNPKRMSFQMACGTAIGAFVGFFETFFVFPWIDGFPLLCMVL
APVFVLGAFLSSRPAYAGYGIGLLVFFAIGSVPNNLTVYDPYTFINDYIGMVIGMFVCAA
AGAIILPPNSRWLWSRLEQALREQVLFAISGRLRGLGSAFESRTRDLLHQAYGLAAGKPQ
VQSQLMGWMFTVLEIGHAVIELRKEQARAPVHPAYAESQPWRQAIRVMGRALTRLFLQPS
ASNHERALVAVDHAIARVQATDEPFARHFDTSVLRRVQSYLHFIRTSLLDPQSPLAPAKG
LHHAP