Protein Info for PP_1231 in Pseudomonas putida KT2440

Annotation: quinolinate synthase [4Fe-4S] cluster subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00550: quinolinate synthetase complex, A subunit
  • amino acids 29 to 341 (313 residues), 371.7 bits, E=1.4e-115
• PF02445: NadA
  • amino acids 34 to 339 (306 residues), 360.1 bits, E=4.1e-112

Best Hits

Swiss-Prot: 100% identical to NADA_PSEP1: Quinolinate synthase A (nadA) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 100% identity to ppu:PP_1231)

MetaCyc: 69% identical to quinolinate synthase (Escherichia coli K-12 substr. MG1655)
Quinolinate synthase. [EC: 2.5.1.72]

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• NAD de novo biosynthesis I (5/6 steps found)
• NAD de novo biosynthesis III (4/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (4/6 steps found)
• nicotine biosynthesis (3/9 steps found)
• superpathway of nicotine biosynthesis (4/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Sequence Analysis Tools

See Q88NH8 at UniProt or InterPro

Protein Sequence (352 amino acids)

>PP_1231 quinolinate synthase [4Fe-4S] cluster subunit (Pseudomonas putida KT2440)
MTQISERLLVQAHLDAKQPNPLTAEQEAEYRAAIAAELKAQNAVLVAHYYCDPVIQALAE
ETGGCVSDSLEMARFGKNHPAETVIVAGVRFMGETAKILTPEKRVLMPTLEATCSLDLGC
PVEEFSAFCDQHPERTVVVYANTSAAVKARADWVVTSSCALEIVESLMDNGETIIWGPDQ
HLGRYIQKQTGADMLLWDGACIVHEEFKSRQLADMKALYPDAAILVHPESPEAVIELADA
VGSTSQLIKAAQTLPNKTFIVATDRGIFYKMQQLCPDKEFVEAPTAGNGAACRSCAHCPW
MAMNTLERVLDCLRNGTNEIFVDPALVPKAIKPLNRMLDFTQAARLKLSGNA