Protein Info for PP_1227 in Pseudomonas putida KT2440

Annotation: putative Membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 90 to 114 (25 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details PF01545: Cation_efflux" amino acids 21 to 228 (208 residues), 66.3 bits, see alignment E=1.6e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_1256)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NI2 at UniProt or InterPro

Protein Sequence (319 amino acids)

>PP_1227 putative Membrane protein (Pseudomonas putida KT2440)
MPNPTRSTFFDITSEQGLLRTSIAATLFIATIGIAFGLASGSFSIVFDGVYSLVDASMSG
LSLVVVKLITSHTTSVQMSRKLRERFTMGFWHLEPMVLALNGILLGGVAIYALINAVSSL
LQGGRHLEFGIAMVYAALTVITCVTIAVIEARANRKLKSDFVRMDVKGWVMSASITAALL
IAFCFGYAVQGTALEWVSPYIDPAVLALVCLVIVPLPMSVVRQALSEIFLVTPGDLKLHV
DEVAKAFVARHGLQSYRAYVAKVGRSREIELYFIVPKTMAAKTIDEWDAWRNEIGDAVGG
EGPDRWLTVVFTGDPEWAE