Protein Info for PP_1221 in Pseudomonas putida KT2440

Annotation: colicin S4 and filamentous phage transport system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details TIGR02794: protein TolA" amino acids 14 to 367 (354 residues), 222.6 bits, see alignment E=9.4e-70 PF13103: TonB_2" amino acids 284 to 348 (65 residues), 39.2 bits, see alignment E=6.5e-14 TIGR01352: TonB family C-terminal domain" amino acids 294 to 366 (73 residues), 45.5 bits, see alignment E=7.5e-16

Best Hits

Swiss-Prot: 61% identical to TOLA_PSEAE: Tol-Pal system protein TolA (tolA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03646, colicin import membrane protein (inferred from 100% identity to ppu:PP_1221)

Predicted SEED Role

"TolA protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NI6 at UniProt or InterPro

Protein Sequence (372 amino acids)

>PP_1221 colicin S4 and filamentous phage transport system (Pseudomonas putida KT2440)
MQQREPSASESYFWPSVWAIGLHVLVFALLFVSFAMTPELPPSKPIVQATLYQLKSKSQA
TTQTNQKIAGEAKKTASRQTEVEQLEQKKVEQEAVKAAEQKKADAAQKAEEAREAAEAKK
AEDAAKAAEAAKAAEAKKAAEAKKADEAKKAAEKQQADIAKKKAEDEAKKKAEEEAKKAA
AEEAKKKAAEDAKKKAAEEAKKKAAEDAKKKAAAEDAKKKAAEEAKKKAAADAQKKKAQE
AARKAAEDKKAQALAELLSDTTERQQALADEQGDQVAGDFDDLIRMRAAEGWARPPSARK
GMTVVLQINMLPDGTITNVSVARSSGDGPYDSSAVAAVKNIGRLTEMQGMKPSDFNQYRS
FKMTFTPEDLAL