Protein Info for PP_1216 in Pseudomonas putida KT2440

Annotation: Holliday junction ATP-dependent DNA helicase RuvA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 PF01330: RuvA_N" amino acids 1 to 62 (62 residues), 94.1 bits, see alignment E=1.1e-30 TIGR00084: Holliday junction DNA helicase RuvA" amino acids 1 to 203 (203 residues), 210.2 bits, see alignment E=9.7e-67 PF14520: HHH_5" amino acids 72 to 130 (59 residues), 59.2 bits, see alignment E=1.2e-19 PF07499: RuvA_C" amino acids 158 to 202 (45 residues), 60.9 bits, see alignment 3.4e-20

Best Hits

Swiss-Prot: 100% identical to RUVA_PSEP1: Holliday junction ATP-dependent DNA helicase RuvA (ruvA) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K03550, holliday junction DNA helicase RuvA (inferred from 98% identity to pen:PSEEN4093)

MetaCyc: 54% identical to Holliday junction branch migration complex subunit RuvA (Escherichia coli K-12 substr. MG1655)
3.1.22.4-RXN [EC: 3.1.21.10]

Predicted SEED Role

"Holliday junction DNA helicase RuvA" in subsystem DNA-replication or RuvABC plus a hypothetical

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NJ1 at UniProt or InterPro

Protein Sequence (205 amino acids)

>PP_1216 Holliday junction ATP-dependent DNA helicase RuvA (Pseudomonas putida KT2440)
MIGRLRGTLAEKQPPHLIIDVNGVGYELEVPMTTLYRLPKVGETVTVHTHLVVREDAHLL
YGFAEKRERELFRELIRLNGVGPKLALALMSGLEVDELVRCVQAQDTSALVRVPGVGKKT
AERLLVELKDRFKAWETSPAMFTLVSDGPLPVASESSAEADAVSALVSLGYKPQEASKAI
AAIKDKAGLSSEELIRRSLKGMISK