Protein Info for PP_1170 in Pseudomonas putida KT2440
Updated annotation (from data): D-glucaro-1,5-lactonase UxuL
Rationale: Specifically important for utilization of D-glucuronate. Glucuronate appears to be oxidized by an oxidative pathway via uronate dehydrogenase (PP_1171). PP_1170 is 72% identical to PSPTO_1052 or UxuL, which a glucaro-1,5-lactonase and a galactaro-1,5-lactonase (see PMC6304669).
Original annotation: Gluconolactonase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 100% identity to ppu:PP_1170)Predicted SEED Role
"Gluconolactonase (EC 3.1.1.17)" in subsystem Entner-Doudoroff Pathway (EC 3.1.1.17)
MetaCyc Pathways
- glucose degradation (oxidative) (5/5 steps found)
- glucose and glucose-1-phosphate degradation (4/5 steps found)
- L-ascorbate biosynthesis VIII (engineered pathway) (5/7 steps found)
- sorbitol biosynthesis II (2/3 steps found)
- L-ascorbate biosynthesis IV (animals, D-glucuronate pathway) (3/6 steps found)
- Entner-Doudoroff pathway II (non-phosphorylative) (5/9 steps found)
- Entner-Doudoroff pathway III (semi-phosphorylative) (5/9 steps found)
- L-ascorbate biosynthesis VI (plants, myo-inositol pathway) (1/4 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.1.1.17
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q88NN7 at UniProt or InterPro
Protein Sequence (293 amino acids)
>PP_1170 D-glucaro-1,5-lactonase UxuL (Pseudomonas putida KT2440) MNCELIVDARNGTGESPVWHPGEQALYWVDIPARQLHRWQAADGKHQCWQGDEMLACIAR SGQGWVAGMESGIFQLQAKADGSLDSRLLSNVQHAQAGMRFNDGRCDRQGRFWAGTMLLD MQQGAHVGALYRHDGEGHLHLQQDGMIVPNGLAFSPDGKRMYLSDSHPNVQKVWAFDYDT DSGTPHGKHLFVDMRNYPGRPDGAAIDQDGCYWICGNDAGQIHRFTPEGRLDRSLSVPVK KPAMCAFGGASLDILYVTSIRPTGIDLSDQPLAGGVFALDPGTKGLEEPAYRG