Protein Info for PP_1170 in Pseudomonas putida KT2440

Updated annotation (from data): D-glucaro-1,5-lactonase UxuL
Rationale: Specifically important for utilization of D-glucuronate. Glucuronate appears to be oxidized by an oxidative pathway via uronate dehydrogenase (PP_1171). PP_1170 is 72% identical to PSPTO_1052 or UxuL, which a glucaro-1,5-lactonase and a galactaro-1,5-lactonase (see PMC6304669).
Original annotation: Gluconolactonase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1170)

Predicted SEED Role

"Gluconolactonase (EC 3.1.1.17)" in subsystem Entner-Doudoroff Pathway (EC 3.1.1.17)

MetaCyc Pathways

glucose degradation (oxidative) (5/5 steps found)
glucose and glucose-1-phosphate degradation (4/5 steps found)
L-ascorbate biosynthesis VIII (engineered pathway) (5/7 steps found)
sorbitol biosynthesis II (2/3 steps found)
L-ascorbate biosynthesis IV (animals, D-glucuronate pathway) (3/6 steps found)
Entner-Doudoroff pathway II (non-phosphorylative) (5/9 steps found)
Entner-Doudoroff pathway III (semi-phosphorylative) (5/9 steps found)
L-ascorbate biosynthesis VI (plants, myo-inositol pathway) (1/4 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NN7 at UniProt or InterPro

Protein Sequence (293 amino acids)

>PP_1170 D-glucaro-1,5-lactonase UxuL (Pseudomonas putida KT2440)
MNCELIVDARNGTGESPVWHPGEQALYWVDIPARQLHRWQAADGKHQCWQGDEMLACIAR
SGQGWVAGMESGIFQLQAKADGSLDSRLLSNVQHAQAGMRFNDGRCDRQGRFWAGTMLLD
MQQGAHVGALYRHDGEGHLHLQQDGMIVPNGLAFSPDGKRMYLSDSHPNVQKVWAFDYDT
DSGTPHGKHLFVDMRNYPGRPDGAAIDQDGCYWICGNDAGQIHRFTPEGRLDRSLSVPVK
KPAMCAFGGASLDILYVTSIRPTGIDLSDQPLAGGVFALDPGTKGLEEPAYRG