Protein Info for PP_1169 in Pseudomonas putida KT2440

Updated annotation (from data): D-glucuronate / D-galacturonate TRAP transporter, solute receptor component
Rationale: Specifically important for utilization of D-glucuronate and D-galacturonate
Original annotation: TRAP dicarboxylate transporter, DctP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF03480: DctP" amino acids 29 to 307 (279 residues), 256.6 bits, see alignment E=1.5e-80 TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 36 to 285 (250 residues), 211.3 bits, see alignment E=8.2e-67

Best Hits

Swiss-Prot: 42% identical to DCTP1_POLSJ: Solute-binding protein Bpro_3107 (Bpro_3107) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1169)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NN8 at UniProt or InterPro

Protein Sequence (323 amino acids)

>PP_1169 D-glucuronate / D-galacturonate TRAP transporter, solute receptor component (Pseudomonas putida KT2440)
MTFKRKLLLAVLPFAFSVAMPASALDIKFAEIHPAGYPTVVAEQNMGKKLEDASNGEITF
KMFAGGVLGSEKEVIEQAQIGAVQMTRVSLGIVGPVVPDVNVFNMPFVFRDHDHMRKIID
GEIGQEILDKITNSDFNLVALAWMDGGSRSIYTKKPVRSLEDLKGMKIRVQGNPLFIDMM
NAMGGNGIAMDTGEIFSALQTGVIDGAENNPPTLLEHNHFQSAKYYTLTGHLILPEPVVM
SKTTWNKLSPEQQALVKKVAREAQMEERALWDAKSAASEEKLKAAGVEFITVDKKPFYDA
TASVREKYGAQYADLMKRIDAVQ