Protein Info for PP_1168 in Pseudomonas putida KT2440

Updated annotation (from data): D-glucuronate / D-galacturonate TRAP transporter, small permease component
Rationale: Specifically important for utilization of D-glucuronate and D-galacturonate
Original annotation: putative TRAP dicarboxylate transporter, DctQ subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details PF04290: DctQ" amino acids 46 to 172 (127 residues), 89.4 bits, see alignment E=9.1e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_1202)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, small permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NN9 at UniProt or InterPro

Protein Sequence (194 amino acids)

>PP_1168 D-glucuronate / D-galacturonate TRAP transporter, small permease component (Pseudomonas putida KT2440)
MPNRPRQCGARRPAALVMPMKSLFLSVNDTLYRSCIWIAGLSILAMTLIIPWGIFARYVL
GTGSSWPEPVSILLMVVFTFVGAAASYRAGAHMAVGMITDRLPPLQRQLVALLVQLLMIV
VCVFMTYYGTRLCITTWNQSLASLPGVRVGMTYAPIPVGGVLTLVFVLEKLLLGDQSNRK
VVRFDLVEENEGAA