Protein Info for PP_1132 in Pseudomonas putida KT2440

Annotation: Na(+)/H(+) antiporter NhaA 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 42 to 59 (18 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 127 to 150 (24 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 216 to 245 (30 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details amino acids 297 to 319 (23 residues), see Phobius details amino acids 331 to 358 (28 residues), see Phobius details amino acids 370 to 390 (21 residues), see Phobius details PF06965: Na_H_antiport_1" amino acids 13 to 386 (374 residues), 495.1 bits, see alignment E=5.9e-153 TIGR00773: Na+/H+ antiporter NhaA" amino acids 14 to 385 (372 residues), 515.2 bits, see alignment E=5.2e-159

Best Hits

Swiss-Prot: 100% identical to NHAA1_PSEPK: Na(+)/H(+) antiporter NhaA 1 (nhaA1) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03313, Na+:H+ antiporter, NhaA family (inferred from 99% identity to ppf:Pput_1168)

MetaCyc: 57% identical to Na+:H+ antiporter NhaA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-129; TRANS-RXN-292

Predicted SEED Role

"Na+/H+ antiporter NhaA type" in subsystem Na(+) H(+) antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NS2 at UniProt or InterPro

Protein Sequence (397 amino acids)

>PP_1132 Na(+)/H(+) antiporter NhaA 1 (Pseudomonas putida KT2440)
MEGLQPVRSLFTRFFQLEAASGLLLIAAAVLALIINNSPLSYLYGGLLEVPVAVQVGALN
IAKPLLLWINDGLMALFFLLIGLEVKREVVDGHLSKPSQVILPATAAVGGMVVPALIYWF
INRDNPAAVAGWAIPTATDIAFALGVLALLGKRVPVSLKLFLMTLAIIDDLGAIIVIALF
YSGTLSSVSLLLAAACLLVLVAMNRLGVIKLGPYMIVGLILWVCVLKSGVHATLAGVALA
FCIPLRTRNAESSPLLALEHALHPWVAYAILPIFAFANAGVSLAGMTVDSFTHPVPMGIT
IGLLLGKTVGVFGLTWVAVKLRLAALPAGAGWGQILGVAILCGIGFTMSLFVGSLAFAPG
SSEYAGMDRMGILTGSFFAAVIGYAVTAMASRKTSIA