Protein Info for PP_1110 in Pseudomonas putida KT2440
Annotation: serine acetyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00640, serine O-acetyltransferase [EC: 2.3.1.30] (inferred from 99% identity to ppf:Pput_1149)Predicted SEED Role
No annotation
MetaCyc Pathways
- superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
- L-cysteine biosynthesis I (2/2 steps found)
- L-cysteine biosynthesis VII (from S-sulfo-L-cysteine) (3/4 steps found)
- seleno-amino acid biosynthesis (plants) (3/5 steps found)
- L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
- N-3-oxalyl-L-2,3-diaminopropanoate biosynthesis (1/4 steps found)
- D-cycloserine biosynthesis (1/6 steps found)
- superpathway of seleno-compound metabolism (8/19 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.30
Use Curated BLAST to search for 2.3.1.30
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q88NU4 at UniProt or InterPro
Protein Sequence (234 amino acids)
>PP_1110 serine acetyltransferase (Pseudomonas putida KT2440) MDMQSAVIARLPVPDELESFKVVKNLVTSALLECCSIVEFEALKETPIIETVTEQAHADL QAFAMKDPAAGRDLVFIAKTYTSYSAVLHYRLAHWIYNNSAATYGAGGQCLAAMISRRGK MLSGAEIHFRSRIGARFIIDHGMGTVIGETSTIGDDCYVLGGVTLGARGISDNPSSPRHP TLGNRVQIGAFASVLGAIHVGDGAFIGPGCIVTKDVPAAARVQVKTSLQVVLES