Protein Info for PP_1094 in Pseudomonas putida KT2440

Annotation: putative electron transport complex protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR01947: electron transport complex, RnfABCDGE type, G subunit" amino acids 10 to 188 (179 residues), 181.2 bits, see alignment E=1.1e-57 PF04205: FMN_bind" amino acids 98 to 184 (87 residues), 62.1 bits, see alignment E=3.2e-21

Best Hits

KEGG orthology group: K03612, electron transport complex protein RnfG (inferred from 100% identity to ppu:PP_1094)

Predicted SEED Role

"Electron transport complex protein RnfG" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NW0 at UniProt or InterPro

Protein Sequence (200 amino acids)

>PP_1094 putative electron transport complex protein (Pseudomonas putida KT2440)
MKRGVRDVGLLLLTGVLAVSATLAWRQWTGPVIAGAEKQLQSRQRLAVLPDGSYDNQPLE
SPLPRPAAQRPNSRILAAYRATMAGKPSAIILITQAQGYAGPIVLSVAITTDGRLIGSQV
VEQQESPGLGDRLGDPRLHWLSQFNNRDHGDHWALKRDQGDFDQLAGATVTSRAVIAALQ
DALSYFDEQRSVLLEGATHE