Protein Info for PP_1085 in Pseudomonas putida KT2440

Annotation: ribonuclease T

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01298: ribonuclease T
  • amino acids 22 to 220 (199 residues), 372.9 bits, E=1.9e-116
• PF00929: RNase_T
  • amino acids 32 to 206 (175 residues), 85.2 bits, E=4e-28

Best Hits

Swiss-Prot: 100% identical to RNT_PSEP1: Ribonuclease T (rnt) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K03683, ribonuclease T [EC: 3.1.13.-] (inferred from 100% identity to ppf:Pput_1126)

MetaCyc: 63% identical to ribonuclease T (Escherichia coli K-12 substr. MG1655)
Ribonuclease D. [EC: 3.1.13.5]; 3.1.13.5 [EC: 3.1.13.5]; 3.1.13.- [EC: 3.1.13.5]

Predicted SEED Role

"Ribonuclease T (EC 3.1.13.-)" in subsystem tRNA processing (EC 3.1.13.-)

MetaCyc Pathways

• tRNA processing (10/10 steps found)

Isozymes

Compare fitness of predicted isozymes for: 3.1.13.5

Use Curated BLAST to search for 3.1.13.- or 3.1.13.5

Sequence Analysis Tools

See Q88NW8 at UniProt or InterPro

Protein Sequence (224 amino acids)

>PP_1085 ribonuclease T (Pseudomonas putida KT2440)
MSEDLYEDDLDTQGSSGPRHPMAERFRGYLPVVVDVETGGFNSATDALLEIAAVTIGMDE
KGFLFPEHTYFHRVEPFEGANIEPAALEFTGIKLDHPLRMAVSEESAMTDIFRGVRKALK
ANGCKRAILVGHNSSFDLGFLNAAVARNDLKRNPFHPFSSFDTATLAGLAYGQTVLARAC
QSADIDFDGREAHSARYDTEKTAELFCGIVNRWKEMGGWRDFND