Protein Info for PP_1079 in Pseudomonas putida KT2440

Annotation: Ornithine carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 TIGR00658: ornithine carbamoyltransferase" amino acids 4 to 299 (296 residues), 371.4 bits, see alignment E=1.6e-115 PF02729: OTCace_N" amino acids 4 to 144 (141 residues), 157 bits, see alignment E=3.8e-50 PF00185: OTCace" amino acids 150 to 297 (148 residues), 175.8 bits, see alignment E=6.9e-56

Best Hits

Swiss-Prot: 100% identical to OTC_PSEPK: Ornithine carbamoyltransferase (argF) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00611, ornithine carbamoyltransferase [EC: 2.1.3.3] (inferred from 100% identity to ppu:PP_1079)

MetaCyc: 42% identical to ornithine carbamoyltransferase (Arabidopsis thaliana col)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.3.3

Use Curated BLAST to search for 2.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NX4 at UniProt or InterPro

Protein Sequence (306 amino acids)

>PP_1079 Ornithine carbamoyltransferase (Pseudomonas putida KT2440)
MSARHFLSLLDFTTDELLGVIRHGIELKDLRKRGVLFEPLKNRVLGMIFEKSSTRTRVSF
EAGMIQLGGQAIFLSPRDTQLGRGEPIGDSAIVLSSMVDVVMIRTHAHSTLTEFAAKSRV
PVINGLSDESHPCQLLADMQTFVEHRGSIQGKTVTWIGDGFNMCNSYIEAARQFDFQLRI
ACPEGYEPDQRFMALGGDRVQIIRDAREAVRDAHLVVTDVWTSMGQEEETARRLAHFAPY
QVTRELLDLAAPDVLFMHCLPAHRGEEISQDLLDDPRSVAWDEAENRLHAQKALLEFLVE
PAYHHA