Protein Info for PP_1063 in Pseudomonas putida KT2440

Annotation: DNA-binding transcriptional regulator, homocysteine-binding

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 PF00126: HTH_1" amino acids 4 to 62 (59 residues), 65.3 bits, see alignment E=3.8e-22 PF03466: LysR_substrate" amino acids 88 to 290 (203 residues), 137.7 bits, see alignment E=3.5e-44

Best Hits

Swiss-Prot: 46% identical to METR_HAEIN: HTH-type transcriptional regulator MetR (metR) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03576, LysR family transcriptional regulator, regulator for metE and metH (inferred from 98% identity to ppw:PputW619_1093)

Predicted SEED Role

"Transcriptional activator MetR" in subsystem Methionine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NZ0 at UniProt or InterPro

Protein Sequence (305 amino acids)

>PP_1063 DNA-binding transcriptional regulator, homocysteine-binding (Pseudomonas putida KT2440)
MLEIRHLKTLHALREADSLVEAAERLHLTQSALSHQFKELEERLGLPIFVRKTKPIRFTS
AGLRLLQLADATLPLLRSAERDIARLAGGTAGRLHMAIECHSCFQWLMPTIDQFRDAWPE
VELDLASGFAFAPLPALARGDLDLVVTSDPVDLAGITYVPLFTYEAMLAVANQHPLASKP
YIVPQDLLDQTLITYPVERDRLDIFTRFLEPADIEPAAVRTSELTVMMMQLVASGRGVCG
MPHWALHEYSSRGYVKGKRLGEKGLFATLYAAVRTDMLDAPYMRDFLLTAKDTSFATLDG
VSAVR