Protein Info for PP_1051 in Pseudomonas putida KT2440

Annotation: Type II secretion pathway protein XcpV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details PF07963: N_methyl" amino acids 17 to 40 (24 residues), 32.1 bits, see alignment 6e-12 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 18 to 40 (23 residues), 32.5 bits, see alignment 2.6e-12 PF02501: T2SSI" amino acids 54 to 132 (79 residues), 58.1 bits, see alignment E=7.7e-20

Best Hits

KEGG orthology group: K02458, general secretion pathway protein I (inferred from 100% identity to ppu:PP_1051)

Predicted SEED Role

"General secretion pathway protein I"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88P02 at UniProt or InterPro

Protein Sequence (135 amino acids)

>PP_1051 Type II secretion pathway protein XcpV (Pseudomonas putida KT2440)
MGLEPHRWHVVSAMKQAQRGFTLLEVTVALAIAAVLAVITSQVLHQRLAVQDNLQQHRLG
LLCARELQARFAVEQYWPAENQVAGELGQGGQRCHWQLQLRRTGVRDLRRGELQLFADRD
QRLPLGQYTVFLERP