Protein Info for PP_1049 in Pseudomonas putida KT2440

Annotation: putative protein secretion protein for export

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details PF07963: N_methyl" amino acids 12 to 37 (26 residues), 36.3 bits, see alignment 2.7e-13 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 15 to 37 (23 residues), 28.7 bits, see alignment 8.2e-11 TIGR01710: type II secretion system protein G" amino acids 16 to 150 (135 residues), 216 bits, see alignment E=1.6e-68 PF08334: T2SSG" amino acids 41 to 149 (109 residues), 141.3 bits, see alignment E=1.2e-45

Best Hits

Swiss-Prot: 59% identical to GSPG_PECCC: Type II secretion system protein G (outG) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: K02456, general secretion pathway protein G (inferred from 100% identity to ppu:PP_1049)

MetaCyc: 50% identical to type II secretion system protein GspG (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"General secretion pathway protein G / Type II secretion envelope pseudopilin (PulG,guides folded protein to PulD in outer membrane)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88P04 at UniProt or InterPro

Protein Sequence (151 amino acids)

>PP_1049 putative protein secretion protein for export (Pseudomonas putida KT2440)
MTTRSIAMQHRRNRQRGFTLMEIMVVIFIIGLLIAVVAPSVLGNQDKAMKQKVMADLATL
EQALDMYRLDNLRFPSNEQGLAALVKKPAQEPLPRAWRSDGYVRRLPEDPWGTPYQYRMP
GEHGRVDVYSLGADGLPGGEGQDADLGNWAL