Protein Info for PP_1048 in Pseudomonas putida KT2440

Annotation: putative protein secretion protein for export

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 165 to 187 (23 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 368 to 392 (25 residues), see Phobius details PF28597: T2SSF_N" amino acids 1 to 41 (41 residues), 50.4 bits, see alignment 1.5e-17 TIGR02120: type II secretion system protein F" amino acids 4 to 397 (394 residues), 529.6 bits, see alignment E=3.1e-163 PF00482: T2SSF" amino acids 66 to 188 (123 residues), 103 bits, see alignment E=1.1e-33 amino acids 269 to 390 (122 residues), 106.9 bits, see alignment E=7e-35

Best Hits

Swiss-Prot: 43% identical to GSPF_AERHY: Type II secretion system protein F (exeF) from Aeromonas hydrophila

KEGG orthology group: K02455, general secretion pathway protein F (inferred from 100% identity to ppu:PP_1048)

Predicted SEED Role

"General secretion pathway protein F / Type II secretory pathway, component PulF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88P05 at UniProt or InterPro

Protein Sequence (400 amino acids)

>PP_1048 putative protein secretion protein for export (Pseudomonas putida KT2440)
MPTYRYQAVDLAGKSHKASLQADSERHARQLLREQGLFARQLQRHDAGSRQPRRQRLSRA
QLCELTRQLATLTGAGIPLVDALATLERQLRQPALHSVLVALRGSLAEGLGLARSLARQG
APFTGLYCALVEAGERSGHLAQVLTRLADHLEQVQRQQHKARTALIYPAVLMGVSLAVVI
GLMTFVVPKLTEQFAHAGQSLPLITSLLIGLSQGLVHAGPWLLGVALLLGGLAGWLLRKP
HWCLRRDQLLLRLPRIGNLLQVLESARLARSLAILCGSGVALLEALQVATETIGNRRIRL
AMEQVRQHVQGGTSLHRALDASQQFPPLLVNMVGSGEASGTLADMLERVADDQERGFARQ
VDTAMALFEPLMILVMGAVVLFIVLAVLLPIMQLNQGLQL