Protein Info for PP_1015 in Pseudomonas putida KT2440

Annotation: mannose/glucose ABC transporter, glucose-binding periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details

Best Hits

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 100% identity to ppu:PP_1015)

Predicted SEED Role

"Glucose ABC transport system, periplasmic sugar-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88P38 at UniProt or InterPro

Protein Sequence (428 amino acids)

>PP_1015 mannose/glucose ABC transporter, glucose-binding periplasmic protein (Pseudomonas putida KT2440)
MNSTLRLAAAISFASLIPLGAQAADAKGSVEVVHWWTSGGEKAAVDVLKAQVEKDGFIWK
DGAVAGGGGATAMTVLKSRAVAGNPPGVAQIKGPDIQDWAATGLLDADVLKDVAKEGKWD
SLLDKKVADTVKYDGDYVAVPVNIHRINWLWINPEVFKKAGIDKAPTTLDEFYAAADKLK
AAGFIPLAHGGQPWQDSTVFESVVLSVMGVDGYKKALVDLDSATLTGPQMVKALTELKKV
ATYMDPDGKGQDWNLEAAKVINGKAGMQIMGDWAKSEWTLAKKTAGKDYQCVPFPGTDKS
FLYNIDSLVVFKQNNAGTSAGQQDIARKVLGEDFQKVFSINKGSIPVRNDMLADMGKYGF
DACAQTSAKDFLADAKTGGLQPSMAHNMATTLAVQGAFFDVVTNYINDPKADPADAAKKL
AAAIKAAQ