Protein Info for PP_1012 in Pseudomonas putida KT2440

Annotation: DNA-binding response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF00072: Response_reg" amino acids 8 to 120 (113 residues), 103.9 bits, see alignment E=5.8e-34 PF00486: Trans_reg_C" amino acids 157 to 233 (77 residues), 67.7 bits, see alignment E=7.8e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1012)

Predicted SEED Role

"DNA-binding response regulator GltR, controls specific porins for the entry of glucose"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88P41 at UniProt or InterPro

Protein Sequence (241 amino acids)

>PP_1012 DNA-binding response regulator (Pseudomonas putida KT2440)
MSTAGKSILMVDDDQEIRELLQTYLSRSGFQVHAEADGKGFRHALETTPCDLVILDVMLP
DEDGFSLCRWVRQHPRQARVPIIMLTASSDEADRVIGLELGADDYLGKPFSPRELQARIK
ALLRRTEFGQTAPGNAVLAFDDWRLDTVSHRLFHRDGEEVILSGADFALLKLFLDHPQQI
LDRDTIGNATRGREPMPLDRIVDMAVSRLRQRLRDTDKPPRLIRTVRGSGYLLAAHVCCA
P