Protein Info for PP_1011 in Pseudomonas putida KT2440

Annotation: glucokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 TIGR00749: glucokinase" amino acids 5 to 310 (306 residues), 261.5 bits, see alignment E=5.3e-82 PF02685: Glucokinase" amino acids 5 to 315 (311 residues), 374.5 bits, see alignment E=3.7e-116 PF00480: ROK" amino acids 8 to 254 (247 residues), 23.6 bits, see alignment E=3.4e-09

Best Hits

Swiss-Prot: 56% identical to GLK_PSEA7: Glucokinase (glk) from Pseudomonas aeruginosa (strain PA7)

KEGG orthology group: K00845, glucokinase [EC: 2.7.1.2] (inferred from 100% identity to ppu:PP_1011)

Predicted SEED Role

"Glucokinase (EC 2.7.1.2)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis (EC 2.7.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88P42 at UniProt or InterPro

Protein Sequence (319 amino acids)

>PP_1011 glucokinase (Pseudomonas putida KT2440)
MKHLLVGDIGGTNARFALWRDNQLHEVNVFATVDYTNPEQAIEAYLESQGIARGGLAAVC
LAVAGPVDGDEFRFTNNHWRLSRTAFCKTLQVERLLLINDFTAMALGMTRLREGEFREVC
PGQADPSRPALVIGPGTGLGVGSLLRLGEQLWKALPGEGGHVDLPVGNAREAAIHQQIHS
QIGHVSAEAVLSGGGLVRLYQAICALDGDTPRHKTPAHITDAALGGEPRALAVVEQFCRF
LGRVAGNNVLTLGARGGVYIVGGVIPRFAELFLRSGFAASFADKGCMSGYFTGVPVWLVT
AEFSGLEGAGVALQQALDH