Protein Info for PP_1008 in Pseudomonas putida KT2440

Annotation: RNA polymerase subunit sigma-24

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 PF04542: Sigma70_r2" amino acids 16 to 74 (59 residues), 42.7 bits, see alignment E=1e-14 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 17 to 159 (143 residues), 84.7 bits, see alignment E=2.8e-28 PF07638: Sigma70_ECF" amino acids 67 to 161 (95 residues), 28.6 bits, see alignment E=3.2e-10 PF04545: Sigma70_r4" amino acids 116 to 151 (36 residues), 31 bits, see alignment 3.7e-11 PF08281: Sigma70_r4_2" amino acids 116 to 159 (44 residues), 48.9 bits, see alignment E=9.9e-17

Best Hits

KEGG orthology group: None (inferred from 99% identity to ppg:PputGB1_1007)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88P45 at UniProt or InterPro

Protein Sequence (170 amino acids)

>PP_1008 RNA polymerase subunit sigma-24 (Pseudomonas putida KT2440)
MSQSRFNSVFLVQRLTLLRTLQRMVGNPSTAEDLLQETYLRVSRALGERPIEHIEPFVFQ
TARNLALDHLRARRVQARMLVDDVPDEVLHSVAAPATSSEDAAHAEQLLKHLSVSLNQLS
ERQQRIFILSRLHGATYLEIAEQLSVSPSTVQKELKLIMAICMGVAERLK