Protein Info for PP_1002 in Pseudomonas putida KT2440

Annotation: arginine/ornithine antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 36 to 60 (25 residues), see Phobius details amino acids 94 to 119 (26 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details amino acids 234 to 256 (23 residues), see Phobius details amino acids 280 to 311 (32 residues), see Phobius details amino acids 332 to 352 (21 residues), see Phobius details amino acids 358 to 382 (25 residues), see Phobius details amino acids 397 to 413 (17 residues), see Phobius details amino acids 419 to 437 (19 residues), see Phobius details amino acids 449 to 469 (21 residues), see Phobius details TIGR00905: transporter, basic amino acid/polyamine antiporter (APA) family" amino acids 2 to 475 (474 residues), 657.6 bits, see alignment E=1.1e-201 TIGR03810: arginine-ornithine antiporter" amino acids 7 to 474 (468 residues), 725.8 bits, see alignment E=2e-222 PF03845: Spore_permease" amino acids 10 to 267 (258 residues), 23.7 bits, see alignment E=3.1e-09 PF13520: AA_permease_2" amino acids 12 to 414 (403 residues), 220.3 bits, see alignment E=7e-69 PF00324: AA_permease" amino acids 16 to 411 (396 residues), 70 bits, see alignment E=2.6e-23

Best Hits

Swiss-Prot: 85% identical to ARCD_PSEAE: Arginine/ornithine antiporter (arcD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03758, arginine:ornithine antiporter (inferred from 100% identity to ppu:PP_1002)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88P51 at UniProt or InterPro

Protein Sequence (475 amino acids)

>PP_1002 arginine/ornithine antiporter (Pseudomonas putida KT2440)
MSDSSGKLKLGALVALVVGSMIGGGIFSLPQNMAASAGVGAVLIGWAITAVGMLTLAFVF
QTLANRKPDLDGGVYAYAKAGFGDYMGFSSAWGYWISAWLGNVGYFVLLFSTLGYFFPIF
GEGNTPAAIIGASILLWAVHFLVLRGIKEAAFINLVTTVAKVVPLVLFALICLFAFRLDI
FTADIWAMGTPELGSVMNQVRNMMLVTVWVFIGIEGASIFSARAEKRTDVGKATVIGFVT
VLLFLVLVNVLSLGIMTQPELAKLQNPSMAAVLEHVVGHWGAVLISVGLVISLLGALLSW
VLLCAEIMFAAAKDHTMPEFLRRENAKQVPANALWLTNAMVQIFLVITLFSSSTYLSLIY
LATSMILVPYLWSAAYAFLLALRSETYEQALAERKKDLIIGGIALLYAIWLLYAGGVKYL
LLSALLYAPGAILFAKAKREVGKPVFTNVEKLIFAAVVIGALVAAYGLYDGFLTL