Protein Info for PP_0966 in Pseudomonas putida KT2440

Annotation: Histidinol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 PF00815: Histidinol_dh" amino acids 30 to 433 (404 residues), 564.2 bits, see alignment E=9.4e-174 TIGR00069: histidinol dehydrogenase" amino acids 39 to 433 (395 residues), 538.2 bits, see alignment E=7.2e-166

Best Hits

Swiss-Prot: 100% identical to HISX_PSEPK: Histidinol dehydrogenase (hisD) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00013, histidinol dehydrogenase [EC: 1.1.1.23] (inferred from 100% identity to ppu:PP_0966)

Predicted SEED Role

"Histidinol dehydrogenase (EC 1.1.1.23)" in subsystem Histidine Biosynthesis (EC 1.1.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P59400 at UniProt or InterPro

Protein Sequence (441 amino acids)

>PP_0966 Histidinol dehydrogenase (Pseudomonas putida KT2440)
MTVSTAIARLNAADPDFARHLDHLLSWESVSDDAVNQRVLDIIKAVRERGDAALVEFTQR
FDGVDAKSIDDLILDRARLELALTRITPVQREALEKAANRVRIYHERQKQDSWQYTEADG
TVLGQKVTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVTEVVMVVPTPRGEVNELVLA
AACIAGVDRVFTVGGAQAVAALAYGTESVPQVDKIVGPGNIYVATAKRHVFGQVGIDMIA
GPSEILVVCDGQTDPDWIAMDLFSQAEHDEDAQAILVSPDAAFLDRVAASIDKLMPTMER
ADIIEKSINGRGALIQVRDMQQAMDVANRIAPEHLELSVADPQAWLPHIRHAGAIFMGRH
TSEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIIFCSEQGASELGHTASVLARG
ESLTAHARSAEYRILTQEKGN