Protein Info for PP_0965 in Pseudomonas putida KT2440

Updated annotation (from data): ATP phosphoribosyltransferase (EC 2.4.2.17)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR00070.
Original annotation: ATP phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00070: ATP phosphoribosyltransferase
  • amino acids 2 to 182 (181 residues), 179.1 bits, E=4.2e-57
• PF01634: HisG
  • amino acids 51 to 202 (152 residues), 172.9 bits, E=2.6e-55

Best Hits

Swiss-Prot: 100% identical to HIS1_PSEPK: ATP phosphoribosyltransferase (hisG) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00765, ATP phosphoribosyltransferase [EC: 2.4.2.17] (inferred from 97% identity to pfo:Pfl01_0870)

Predicted SEED Role

"ATP phosphoribosyltransferase (EC 2.4.2.17)" in subsystem Histidine Biosynthesis (EC 2.4.2.17)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.17

Use Curated BLAST to search for 2.4.2.17

Sequence Analysis Tools

See Q88P87 at UniProt or InterPro

Protein Sequence (211 amino acids)

>PP_0965 ATP phosphoribosyltransferase (EC 2.4.2.17) (Pseudomonas putida KT2440)
MLTIALSKGRILDDTLPLLAEAGIVPTENPDKSRKLIIPTTQDDVRLLIVRATDVPTYVE
HGAADLGVAGKDVLMEYGGQGLYEPLDLQIAQCKLMTAGVVGAAEPKGRLRVATKFVNVA
KRYYAEQGRQVDIIKLYGSMELAPLINLADKIIDVVDTGNTLRANGLEPQELIATISSRL
VVNKASMKMQHARIQSLIDTLRAAVESRHRG