Protein Info for PP_0961 in Pseudomonas putida KT2440

Annotation: toluene tolerance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF05494: MlaC" amino acids 31 to 195 (165 residues), 153.1 bits, see alignment E=3.1e-49

Best Hits

Swiss-Prot: 96% identical to TTG2D_PSEPU: Toluene tolerance protein ttg2D (ttg2D) from Pseudomonas putida

KEGG orthology group: K07323, putative toluene tolerance protein (inferred from 100% identity to ppf:Pput_1000)

Predicted SEED Role

"Uncharacterized ABC transporter, auxiliary component YrbC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88P91 at UniProt or InterPro

Protein Sequence (215 amino acids)

>PP_0961 toluene tolerance protein (Pseudomonas putida KT2440)
MISILRRGLLVLLAAFPLLALAVQTPHEVVQSTTNELLGDLKANKEQYKSNPNAFYDSLN
RILGPVVDADGISRSIMTVKYSRKATPEQMQRFQENFKRSLMQFYGNALLEYNNQGITVD
PAKADDGKRASVGMKVTGNNGAVYPVQYTLENIGGEWKVRNVIVNGINIGKLFRDQFADA
MQRNGNDLDKTIDGWAGEVAKAKQAADNSPEKSVK