Protein Info for PP_0944 in Pseudomonas putida KT2440

Annotation: fumarate hydratase (class 2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 PF00206: Lyase_1" amino acids 13 to 337 (325 residues), 299.3 bits, see alignment E=3.9e-93 PF10415: FumaraseC_C" amino acids 403 to 455 (53 residues), 76.3 bits, see alignment 2e-25

Best Hits

Swiss-Prot: 79% identical to FUMC2_PSEAE: Fumarate hydratase class II 2 (fumC2) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01679, fumarate hydratase, class II [EC: 4.2.1.2] (inferred from 100% identity to ppu:PP_0944)

MetaCyc: 46% identical to fumarase C (Escherichia coli K-12 substr. MG1655)
Fumarate hydratase. [EC: 4.2.1.2]

Predicted SEED Role

"Fumarate hydratase class II (EC 4.2.1.2)" in subsystem TCA Cycle (EC 4.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.2

Use Curated BLAST to search for 4.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PA6 at UniProt or InterPro

Protein Sequence (459 amino acids)

>PP_0944 fumarate hydratase (class 2) (Pseudomonas putida KT2440)
MMSDTRIERDSMGELQVPAQALYGAQTQRAVDNFPISGQRMPAQFIRALLLAKAAAAKAN
VELEQLSAGQGQAIVKAVEQLLAEDFIQHFPVDVFQTGSGTSSNMNANEVIATLATHVLG
EAVNANDHVNCGQSSNDIIPTTIHVSAALALHEQLLPALAHLVQVIEVKSAQVHQYVKTG
RTHLMDAMPVRMSQVLDGWAAQINAAKSHIEGVLPHLQALAQGGTAVGTGINAHPQFAVG
FARQLSGLTKVEFTPGQNLFALIGSQDTAVALSGQLKTTAVALMKIANDLRWMNSGPLAG
LGEIELQALQPGSSIMPGKVNPVIPEATAMVAAQVIGNDATIAVAGQAGNFELNVMLPVI
ARNLLESIELMANVSRLLADKAIASFKVNEDKLKEALARNPILVTALNPIIGYLKAAEIA
KTAYKQGRPIIDVALEHTDLSRDQLEALLDPEKLTAGGI