Protein Info for PP_0941 in Pseudomonas putida KT2440

Annotation: putative ribosome associated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF04751: DUF615" amino acids 12 to 163 (152 residues), 190.3 bits, see alignment E=9.8e-61

Best Hits

Swiss-Prot: 100% identical to Y941_PSEPK: UPF0307 protein PP_0941 (PP_0941) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K09889, ribosome-associated protein (inferred from 100% identity to ppu:PP_0941)

Predicted SEED Role

"FIG138315: Putative alpha helix protein" in subsystem Putative TldE-TldD proteolytic complex

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PA9 at UniProt or InterPro

Protein Sequence (173 amino acids)

>PP_0941 putative ribosome associated protein (Pseudomonas putida KT2440)
MVDSNDDAFDGEKSKTQIKRELHALVELGERLTTLKADTLARLPLTDELRKALAEASKHT
AHGARKRHMSFVGKLMRVQDLDAIHALLEQMDSSTRQYNERFHSLERWRDRLIDGNDEDL
ERFVNEYPDTDRQQLRSLVRHAQHEKARNKPPAAARKVFKYIRDLDELQRGLR