Protein Info for PP_0927 in Pseudomonas putida KT2440

Annotation: aromatic amino acid transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 45 to 62 (18 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 125 to 142 (18 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 195 to 219 (25 residues), see Phobius details amino acids 240 to 262 (23 residues), see Phobius details amino acids 282 to 303 (22 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 358 to 381 (24 residues), see Phobius details amino acids 403 to 421 (19 residues), see Phobius details amino acids 427 to 444 (18 residues), see Phobius details PF00324: AA_permease" amino acids 18 to 449 (432 residues), 423.7 bits, see alignment E=9.1e-131 PF13520: AA_permease_2" amino acids 22 to 434 (413 residues), 119.2 bits, see alignment E=2.3e-38

Best Hits

Swiss-Prot: 70% identical to AROP_ECOL6: Aromatic amino acid transport protein AroP (aroP) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 100% identity to ppf:Pput_0967)

MetaCyc: 69% identical to aromatic amino acid:H+ symporter AroP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-56; TRANS-RXN-76; TRANS-RXN-77

Predicted SEED Role

"Aromatic amino acid transport protein AroP" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PC3 at UniProt or InterPro

Protein Sequence (453 amino acids)

>PP_0927 aromatic amino acid transport protein (Pseudomonas putida KT2440)
MQDQSTPERLQRGLKNRHIQLIALGGAIGTGLFLGIAQTIQLAGPSVLLGYAIAGLMAFL
IMRQLGEMVVEEPVAGSFSHFAHQYWSEFAGFVSGWNYWVVYVLVGMAELTAVGIYVQYW
WPDFPTWATAAIFFVVINLINLTQVKVYGEMEFWFALVKVVAIVSMIGFGAWLLGSGHGG
PDASVANLWQYGGFFPNGVTGLVMALAVIMFSFGGLELVGITAAEADNPRESIPKATNQV
VYRILIFYIGALAVLLSLYPWQKVVQGGSPFVMIFHELDSDLVATILNIVVLTAALSVYN
SCVYANSRMLFGLASQGDAPRQLLKVSRSGVPLTALAVSAFATGLCVLINYLMPGGAFGL
LMALAVSALVINWASISITHLKFRKAKLAAGITPFYKSLGHPLTNYLCLAFIVLILVVMY
LTPPIRISVMLIPAWIAVLWVAFKLKKARQAKG