Protein Info for PP_0916 in Pseudomonas putida KT2440

Annotation: Amino acid transporter LysE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details PF01810: LysE" amino acids 20 to 203 (184 residues), 148.8 bits, see alignment E=6.8e-48

Best Hits

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 100% identity to ppu:PP_0916)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PD4 at UniProt or InterPro

Protein Sequence (204 amino acids)

>PP_0916 Amino acid transporter LysE (Pseudomonas putida KT2440)
MESPAMWQSYLNGMLVAFGLIMAIGAQNAFVLAQSLRREHHLPVAALCIVCDAILVAAGV
FGLATVLAHNPTLLAIARWGGAVFLIWYGAKALRSACSKQSLQHQQGQGVRSRRAVLLSA
LAVTLLNPHVYLDTVLLIGSLGAQQSAPGAYVAGAASASLLWFSTLAIGAAWLAPWLARP
ATWRMLDLMVAVMMFAVAAQLIFN