Protein Info for PP_0915 in Pseudomonas putida KT2440

Annotation: superoxide dismutase (Fe)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 PF00081: Sod_Fe_N" amino acids 3 to 82 (80 residues), 116.1 bits, see alignment E=8.1e-38 PF02777: Sod_Fe_C" amino acids 89 to 189 (101 residues), 133.6 bits, see alignment E=2.5e-43

Best Hits

Swiss-Prot: 100% identical to SODF_PSEPK: Superoxide dismutase [Fe] (sodB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 100% identity to ppw:PputW619_0981)

MetaCyc: 70% identical to superoxide dismutase (Fe) (Escherichia coli K-12 substr. MG1655)
Superoxide dismutase. [EC: 1.15.1.1]

Predicted SEED Role

"Superoxide dismutase [Fe] (EC 1.15.1.1)" in subsystem Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PD5 at UniProt or InterPro

Protein Sequence (198 amino acids)

>PP_0915 superoxide dismutase (Fe) (Pseudomonas putida KT2440)
MAFELPPLPYAHDALQPHISKETLEYHHDKHHNTYVVNLNNLVPGTEFEGKTLEEIVKSS
SGGIFNNAAQVWNHTFYWNCLSPNGGGQPTGALADAINAAFGSFDKFKEEFTKTSVGTFG
SGWGWLVKKADGSLALASTIGAGCPLTSGDTPLLTCDVWEHAYYIDYRNLRPKYVEAFWN
LVNWAFVAEQFEGKTFKA