Protein Info for PP_0914 in Pseudomonas putida KT2440

Annotation: GGDEF domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 693 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details amino acids 163 to 191 (29 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 256 to 419 (164 residues), 104.1 bits, see alignment E=3.2e-34 PF00990: GGDEF" amino acids 260 to 417 (158 residues), 123.2 bits, see alignment E=8.9e-40 PF00563: EAL" amino acids 437 to 672 (236 residues), 264.8 bits, see alignment E=6.2e-83

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_0953)

Predicted SEED Role

"GGDEF domain/EAL domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PD6 at UniProt or InterPro

Protein Sequence (693 amino acids)

>PP_0914 GGDEF domain protein (Pseudomonas putida KT2440)
MPCAWIKETPLKLELRNSLSVKLLRVVLLSALAVGVVLSCAQIIYDTYKTRQAVDSDAQR
ILDMFRDPSTQAVYSLDREMGMQVMEGLFQDESVRMASIGHPNETMLAEKSRPLQDMSMR
WLTDLILGQERTYTTQLVGRGPYSEYYGDLSITLDTSSYGKDFLINAVIIFISGVLRAMA
MGLVLYLVYHWLLTKPLSKIIEHLTQINPDRPSQHQIPLLKGHEKNELGLWVNTANQLLA
SIERNTHLRHEAENSLQRMAQYDFLTGLPNRQQLQQQLDKILVDGGRLQHRVAVLCVGLD
DFKGINEQFSYQVGDQLLLALADRLRAHSGRLGALARLGGDQFALVQANIEQPYEAAELA
QSILDDLEVPFDLDHEQIRLRATIGITLFPEDGDSTEKLLQKAEQTMTLAKARSRNRYQF
YIASVDSEMRRRRELEKDLREALPRNQLYLVYQPQISYRDHRVVGVEALLRWQHPELGMV
PPDQFIPLAEQNGSIISIGEWVLDQACRQLREWHDQGFSDLRMAVNLSTVQLHHSELPRV
VNNLLQAYRLPPRSLELEVTETGLMEDISTAAQHLLSLRRSGALIAIDDFGTGYSSLSYL
KSLPLDKIKIDKSFVQDLLDDDDDATIVRAIIQLGKSLGMQVIAEGVETAEQETYIVAQG
CHEGQGYHYSKPLSARELTHFLKQAQRNRVSVS