Protein Info for PP_0907 in Pseudomonas putida KT2440

Annotation: RND efflux membrane fusion protein-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 65 to 387 (323 residues), 268 bits, see alignment E=4.7e-84 PF25917: BSH_RND" amino acids 91 to 210 (120 residues), 48.3 bits, see alignment E=1.8e-16 PF25944: Beta-barrel_RND" amino acids 221 to 294 (74 residues), 44.1 bits, see alignment E=5.9e-15 PF25954: Beta-barrel_RND_2" amino acids 222 to 292 (71 residues), 71 bits, see alignment E=2e-23 PF25967: RND-MFP_C" amino acids 345 to 375 (31 residues), 24.4 bits, see alignment (E = 5.7e-09)

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0907)

Predicted SEED Role

"Probable RND efflux membrane fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PE3 at UniProt or InterPro

Protein Sequence (406 amino acids)

>PP_0907 RND efflux membrane fusion protein-related protein (Pseudomonas putida KT2440)
MGRIARCRVEANNNCIQGTGPMLRRRMLIMLAVVLLIVLALGGYKAFSIYQQIQMFTAPK
PPITVAAAMAEQRPWQERLPAVGSLKALQGVDLSLEVEGIVKSLHFDSGQQVKAGQLLLQ
LNDDQETALLGTALADLGLAKVDFGRGSQLVGDSAISRGEFDRLSSQYRRNQAVVEQLKA
QKIKKRINAPFSGTIGIRQVDIGQYLAAGTVIATLQDTSSLYVDFNVPEQALPHLSLGQQ
VLVQVAAYPGQRFPGSLSAINPKVEETTRNLLVRATMANPDGKLLPGMFASLLILLPNPQ
PQVVVPESAITYTLYGNSVYVASPRKDKDGKPVYDDKGQPQLVAEQRTVKTGERRDGVVV
VSEGLQAGEQVVTAGQLKLTPGAAIRIGQDNALKPEPGAAAKDSGG