Protein Info for PP_0887 in Pseudomonas putida KT2440

Annotation: Sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 51 to 70 (20 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 135 to 176 (42 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details PF02518: HATPase_c" amino acids 345 to 444 (100 residues), 72.9 bits, see alignment E=1.4e-24

Best Hits

KEGG orthology group: K15011, two-component system, sensor histidine kinase RegB [EC: 2.7.13.3] (inferred from 100% identity to ppu:PP_0887)

Predicted SEED Role

"Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PG3 at UniProt or InterPro

Protein Sequence (450 amino acids)

>PP_0887 Sensor histidine kinase (Pseudomonas putida KT2440)
MTKCGALPHRCSEAPGFGILQPIFLEHSSGELMLAAVQPLSATRQNLWRLTVIRVLVLAA
QAGSVGVAYWTELLPLPWLSLAGTLALSSLLCAFTALRLRLSLPVTEMEYALQLACDLLI
HSALLYYSGGSTNPFVSYYLVPLAIAAVTLPWLYSLILSGIALTAYSLLLVQFYPLEGLP
MARDKMQVYGMWLSIALAAAVITFFAARMAEELRRQEQLRSERREESLRDEQLLAVATQA
AGAAHELGTPLATMSVLINEMRQDHTDPLLQEDLQILQDQVKLCKETLQQLVRAAEANRR
LAIVEQDVTAWLDEALNRWHLMRPEASYRFQRLRDGKVPRLAPPPDLTQALLNLLNNAAD
ACPDDLEVRLDWDAQDIVISIHDHGPGVPPAIAEAIGKPFITTKGKGFGLGLFLSKASVT
RAGGSVKLYSHEQGGTLTELRLPYGKRGDE