Protein Info for PP_0872 in Pseudomonas putida KT2440

Annotation: Peptide chain release factor 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 TIGR00503: peptide chain release factor 3" amino acids 3 to 526 (524 residues), 849.9 bits, see alignment E=6.4e-260 PF00009: GTP_EFTU" amino acids 11 to 274 (264 residues), 161.2 bits, see alignment E=5.7e-51 TIGR00231: small GTP-binding protein domain" amino acids 13 to 146 (134 residues), 58.9 bits, see alignment E=5.2e-20 PF03144: GTP_EFTU_D2" amino acids 311 to 377 (67 residues), 46.3 bits, see alignment E=1.2e-15 PF16658: RF3_C" amino acids 384 to 511 (128 residues), 157.8 bits, see alignment E=3.2e-50 PF14492: EFG_III" amino acids 396 to 459 (64 residues), 28.2 bits, see alignment E=4.1e-10

Best Hits

Swiss-Prot: 100% identical to RF3_PSEPK: Peptide chain release factor 3 (prfC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02837, peptide chain release factor 3 (inferred from 99% identity to pen:PSEEN1047)

Predicted SEED Role

"Peptide chain release factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PH8 at UniProt or InterPro

Protein Sequence (527 amino acids)

>PP_0872 Peptide chain release factor 3 (Pseudomonas putida KT2440)
MTNQAAEVAKRRTFAIISHPDAGKTTITEKLLLMGKAIAVAGTVKSRKSDRHATSDWMEM
EKQRGISITTSVMQFPYREHMINLLDTPGHEDFSEDTYRTLTAVDSALMVLDGGKGVEPR
TIALMDVCRLRDTPIVSFINKLDRDIRDPIELLDEIEAVLKIKAAPITWPIGCYRDFKGV
YHLTGDYIVVYTPGHGHERTEAKIIQKLDSDEARAHLGDQYDSFVEQLELVQGACHEFNQ
EEFINGQLTPVFFGTALGNFGVDHVLDAVVDWAPRPLGRVAHERTVEPVEEKFTGFVFKI
QANMDPKHRDRIAFMRICSGKYEKGMKMRHVRLNKDLRIGDALTFFSSEREQLEEAFAGD
IIGLHNHGTIQIGDTFTEGEALGFTGIPHFAPELFRRVRLKDPLKSKQLRQGLQQLAEEG
ATQVFFPERSNDIILGAVGVLQFDVVASRLKEEYKVECAYEPITVWSARWISCDDKKKLE
EFQTKAMENLAIDGGGHLTYLAPTRVNLALMEERWPDIKFRATREHH