Protein Info for PP_0871 in Pseudomonas putida KT2440

Annotation: putative Glycine betaine/carnitine/choline ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 transmembrane" amino acids 19 to 38 (20 residues), see Phobius details amino acids 50 to 77 (28 residues), see Phobius details amino acids 99 to 130 (32 residues), see Phobius details amino acids 172 to 209 (38 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 70 to 239 (170 residues), 83.6 bits, see alignment E=7.8e-28

Best Hits

Swiss-Prot: 61% identical to OSMY_SALTY: Osmoprotectant import permease protein OsmY (osmY) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 100% identity to ppu:PP_0871)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PH9 at UniProt or InterPro

Protein Sequence (247 amino acids)

>PP_0871 putative Glycine betaine/carnitine/choline ABC transporter, permease protein (Pseudomonas putida KT2440)
MLADYTRSPPVAKRYGKGLLGWAAVLVILALLVHWIGIDTIARYRDDLGFYLQAHLVLVL
ASMAAALAVGIPAGIALSRPHRVDKAERFMQFFNVGNTIPPLAVLAIALSILGIGAGPAI
FALFLASLLPIVRNTYEGLKNVPASLKEAATGIGMTPRQQLWQVELPNAVPIIVGGVRVA
LALNVGTAPLAFLIGANSLGSLIFPGIALNNQPQLLLGAACTALLALVLDAAVSFSSRRW
LERGLAQ