Protein Info for PP_0859 in Pseudomonas putida KT2440

Annotation: putative ketoglutaramate omega-amidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF00795: CN_hydrolase" amino acids 11 to 248 (238 residues), 117.7 bits, see alignment E=2.9e-38

Best Hits

Swiss-Prot: 53% identical to YAFV_YEREN: Omega-amidase YafV (yafV) from Yersinia enterocolitica

KEGG orthology group: K08590, carbon-nitrogen hydrolase family protein (inferred from 100% identity to ppf:Pput_0889)

Predicted SEED Role

"Aliphatic amidase AmiE (EC 3.5.1.4)" (EC 3.5.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.4

Use Curated BLAST to search for 3.5.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PJ1 at UniProt or InterPro

Protein Sequence (263 amino acids)

>PP_0859 putative ketoglutaramate omega-amidase (Pseudomonas putida KT2440)
MRDLSTLPNLKVALVQTTLAWHDREANYAHFEVLLEQVGEVDLVILPEMFTTGFSMQSES
LCEPENGPTYKWLKAQARKHNAVITGSVIIQAADGSHRNRLLWARPDGEILHYDKRHLFR
MAGEHKHYTPGERQVQFELKGWRIRPLICYDLRFPVWSRDAQDTDLLLYTANWPAARRQH
WNRLLPARGIENLCYVAAVNRVGTDGKGFAYSGDSQVLDFQGESLLSAGEADGVFTAVLS
AAELAAYRAKFPANLDADTFELH