Protein Info for PP_0848 in Pseudomonas putida KT2440

Annotation: donor of Fe2+ and regulator of cysteine desulfurase activity

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 66 PF04384: Fe-S_assembly" amino acids 3 to 65 (63 residues), 103.7 bits, see alignment E=3.3e-34 TIGR03412: FeS assembly protein IscX" amino acids 4 to 66 (63 residues), 110.6 bits, see alignment E=2.4e-36

Best Hits

Swiss-Prot: 86% identical to Y3808_PSEAE: Uncharacterized protein PA3808 (PA3808) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 96% identity to pfl:PFL_4959)

Predicted SEED Role

"Believed to be involved in assembly of Fe-S clusters"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PK2 at UniProt or InterPro

Protein Sequence (66 amino acids)

>PP_0848 donor of Fe2+ and regulator of cysteine desulfurase activity (Pseudomonas putida KT2440)
MSLKWVDVLEIAIQLAESKPEVDPRYVNFVDLHRWVLALPEFSDDPSRGGEKVLEAIQAA
WIDEAD